PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS515031.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GeBP
Protein Properties Length: 233aa    MW: 26709.4 Da    PI: 10.2563
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS515031.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57394.98.1e-30599297
        DUF573  2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                  +fq++w ++Dei lLqG+id+  ++g++p+++++afy+ vk+ +  + + sql +K+  +KkK+++++ k k g++ +fs++h+ kifelskkiW+
  EcS515031.10  5 AFQKIWRDDDEINLLQGIIDY-REKGMNPFSNVSAFYHDVKGLLWEDLTVSQLANKVWVFKKKYRNNKGKGKVGEDRVFSNSHEGKIFELSKKIWD 99
                  59*******************.789**********************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.3E-26699IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
SKKLAFQKIW RDDDEINLLQ GIIDYREKGM NPFSNVSAFY HDVKGLLWED LTVSQLANKV  60
WVFKKKYRNN KGKGKVGEDR VFSNSHEGKI FELSKKIWDV EMRGNATSSR EEIGVTKNKK  120
TDGAGMFVAS PQSKSEASKS NVLQEHLDNI SQMCRVGLDE GSLNQGLALL EPSKRAELKE  180
RWSKLLEHYA THQNTWSLKK IYKMTKNSHQ NHGAQNSIVR MLYHPSKNLK PTT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039656.11e-126PREDICTED: mediator-associated protein 1-like
RefseqXP_010039902.11e-126PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.16e-14DNA-binding storekeeper protein-related transcriptional regulator